powered by:
Protein Alignment CG33914 and AgaP_AGAP011012
DIOPT Version :9
| Sequence 1: | NP_001027394.2 |
Gene: | CG33914 / 3772464 |
FlyBaseID: | FBgn0053914 |
Length: | 189 |
Species: | Drosophila melanogaster |
| Sequence 2: | XP_001688218.1 |
Gene: | AgaP_AGAP011012 / 5667809 |
VectorBaseID: | AGAP011012 |
Length: | 116 |
Species: | Anopheles gambiae |
| Alignment Length: | 55 |
Identity: | 10/55 - (18%) |
| Similarity: | 25/55 - (45%) |
Gaps: | 10/55 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 90 SNWQPFLHTMKLDLCRFW-KNHHNHLARMVFEFIDGHTNMNHTCPYTKEKYISID 143
|.| :|.|..: |.....:.|:.::.:..::.:: :|||...:.|.::
Mosquito 20 SRW--------VDGCEVYRKPPTERIVRLFYDPVIKYSKIS-SCPYKAGQTIMLN 65
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| CG33914 | NP_001027394.2 |
DUF1091 |
85..166 |
CDD:284008 |
10/55 (18%) |
| AgaP_AGAP011012 | XP_001688218.1 |
DUF1091 |
3..84 |
CDD:284008 |
10/55 (18%) |
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| Panther |
1 |
1.100 |
- |
- |
O |
PTHR20898 |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.