DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33914 and CG33725

DIOPT Version :9

Sequence 1:NP_001027394.2 Gene:CG33914 / 3772464 FlyBaseID:FBgn0053914 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001027125.1 Gene:CG33725 / 3772600 FlyBaseID:FBgn0053725 Length:181 Species:Drosophila melanogaster


Alignment Length:187 Identity:49/187 - (26%)
Similarity:89/187 - (47%) Gaps:27/187 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KLLGLLLCL---LFLTELH-GVFMRFTNVTCESKDLSMSIVEYCAVTTLSKNKNSISLRYAMLKP 67
            ||:..:||:   :.:.:|: .|..:|||..|.|::.|..:...|.:..:|:.|..::....:|.|
  Fly     4 KLVTSILCVAVGILVIDLNDAVVFKFTNFACLSRNQSWFVFHNCRLKAVSREKVLLNFNGTVLHP 68

  Fly    68 MFTNIEIYFQLMTRGSESIHAASNWQPFLHTMKLDLCRFWKNHHNHLARMVFEFIDGHTNMNHTC 132
            . .||.::.:|..:       |:.::|:|..:|||.|||.:.:.:...|::|:.....:.:||||
  Fly    69 A-NNIIVHVKLFKK-------ANGFKPWLLDVKLDACRFVRTNFHPFVRIIFDLFKDFSTINHTC 125

  Fly   133 PY-----TKEKYISIDDLTNTEVSAKIRGVPMPKGFYALFTTWSTENITRVVTNFYF 184
            ||     .|:.|:..:.|.          :|.|.|.|.|...|..:...:..||..|
  Fly   126 PYVGLQVVKDFYLRPEKLK----------LPFPSGDYLLSLIWIFDKRPQFDTNVSF 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33914NP_001027394.2 DUF1091 85..166 CDD:284008 24/85 (28%)
CG33725NP_001027125.1 DUF1091 74..154 CDD:284008 25/96 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472381
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.