DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33914 and CG33769

DIOPT Version :9

Sequence 1:NP_001027394.2 Gene:CG33914 / 3772464 FlyBaseID:FBgn0053914 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001027143.1 Gene:CG33769 / 3772499 FlyBaseID:FBgn0053769 Length:179 Species:Drosophila melanogaster


Alignment Length:102 Identity:25/102 - (24%)
Similarity:38/102 - (37%) Gaps:20/102 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GKLLGLLLCLLFLT---ELHGVFMRFTNVTCESKDLSMS-----------IVEYCAVTTLS---K 53
            |||:..:|..:.:|   :..|..|.|....|.....:.|           |::...||||.   |
  Fly     4 GKLVPFVLGCVVVTVVIKQSGPRMTFRAGDCTYNRSTFSNFSIQIIKTKVIMDMILVTTLRQGLK 68

  Fly    54 NKNSISLRYAMLKP---MFTNIEIYFQLMTRGSESIH 87
            ...|...|....||   ::.:...|..|:....|||:
  Fly    69 AHLSFEFRLTKAKPYQSVYQHDMNYCALIKGSQESIY 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33914NP_001027394.2 DUF1091 85..166 CDD:284008 2/3 (67%)
CG33769NP_001027143.1 DM8 82..173 CDD:214778 6/24 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448034
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.