DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33914 and CG33773

DIOPT Version :9

Sequence 1:NP_001027394.2 Gene:CG33914 / 3772464 FlyBaseID:FBgn0053914 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001027213.1 Gene:CG33773 / 3772436 FlyBaseID:FBgn0053773 Length:179 Species:Drosophila melanogaster


Alignment Length:188 Identity:46/188 - (24%)
Similarity:88/188 - (46%) Gaps:21/188 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KLLGLLLCLLFLTELHGVFMR--FTNVTCESKDLSMSIVEYCAVTTLSKNKNSISLRYAMLKPMF 69
            |.:.|:|.:|....:.....|  |||:.|.:.||.:...|.|.:.:::::...:|.:|.:.:...
  Fly     4 KRINLILAILIFYSIIKTNSRFEFTNLNCTAFDLRVGEFENCNLKSINRSYKYVSGKYKLNQIPL 68

  Fly    70 TNIEIYFQLMTRGSESIHAASNWQPFLHTMKLDLCRFWKN-HHNHLARMVFEFIDGHTNMNHTCP 133
            ..:::.|.:..|       .:.::|||:.:..|.|:|.:| ..|.:.:.:|:....::||||:||
  Fly    69 PRMKVNFIMWKR-------LNGYRPFLYNITADACKFVENPKSNPVLKYIFDSFSAYSNMNHSCP 126

  Fly   134 YTKEKY-----ISIDDLTNTEVSAKIRGVPMPKGFYALFTTWSTENITRVVTNFYFEV 186
            ||.:..     |...:|..||:      :|.|:|.|.....:|........|..||.:
  Fly   127 YTSDLIVERLPIGFMNLRVTEI------LPFPEGNYLFEFHFSRRKSIFASTQVYFTI 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33914NP_001027394.2 DUF1091 85..166 CDD:284008 25/86 (29%)
CG33773NP_001027213.1 DUF1091 73..158 CDD:284008 27/97 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472273
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.