powered by:
Protein Alignment CG33914 and CG33643
DIOPT Version :9
| Sequence 1: | NP_001027394.2 |
Gene: | CG33914 / 3772464 |
FlyBaseID: | FBgn0053914 |
Length: | 189 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001027258.1 |
Gene: | CG33643 / 3772011 |
FlyBaseID: | FBgn0053643 |
Length: | 178 |
Species: | Drosophila melanogaster |
| Alignment Length: | 31 |
Identity: | 11/31 - (35%) |
| Similarity: | 14/31 - (45%) |
Gaps: | 8/31 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 14 CLLF-------LTELHG-VFMRFTNVTCESK 36
|||. |..::. .|.||:||.|..|
Fly 95 CLLLGSIQKNRLVNIYSKTFKRFSNVECPLK 125
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| CG33914 | NP_001027394.2 |
DUF1091 |
85..166 |
CDD:284008 |
|
| CG33643 | NP_001027258.1 |
DUF1091 |
75..152 |
CDD:284008 |
11/31 (35%) |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
1 |
1.100 |
- |
- |
P |
PTHR20898 |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.
