DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33914 and CG14492

DIOPT Version :9

Sequence 1:NP_001027394.2 Gene:CG33914 / 3772464 FlyBaseID:FBgn0053914 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_611275.2 Gene:CG14492 / 37045 FlyBaseID:FBgn0034283 Length:199 Species:Drosophila melanogaster


Alignment Length:109 Identity:20/109 - (18%)
Similarity:47/109 - (43%) Gaps:12/109 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 NVTCESKDLSMSIV-EYCAVTTLSKNKNSISLRYAMLKPMFTNIEIYFQLMTRGSESIHAASNWQ 93
            |.||.|.|:|.|:: |:....:.|..:.:..:.:.:.:|:..: :.:.:::......:       
  Fly    38 NFTCSSDDISSSVLKEFTCGISKSTKRRTWHMEFVLEQPVAEH-DFFIKIVLPRRRPL------- 94

  Fly    94 P--FLHTMKLDLCRFWKNHHN-HLARMVFEFIDGHTNMNHTCPY 134
            |  .|..:..|.|:...|.:. .|.|:....::..:|....||:
  Fly    95 PDFVLLNVTTDGCQLLANRNQVPLMRLGRNIMERFSNFPKQCPF 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33914NP_001027394.2 DUF1091 85..166 CDD:284008 10/53 (19%)
CG14492NP_611275.2 DM8 95..186 CDD:214778 10/44 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.