DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33914 and CG33467

DIOPT Version :10

Sequence 1:NP_001027394.2 Gene:CG33914 / 3772464 FlyBaseID:FBgn0053914 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001286440.1 Gene:CG33467 / 2768834 FlyBaseID:FBgn0053467 Length:188 Species:Drosophila melanogaster


Alignment Length:182 Identity:41/182 - (22%)
Similarity:69/182 - (37%) Gaps:39/182 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLGLLLCLL-FLTELHGVFMRFTNVTCESKDLSMSIVEYCAVTTLSKNKNSISLRYAMLKPMFTN 71
            |:.|.:|.: .:|:...|: :||.|.|:.....:..|. |.|..::.|...::|...::.|:. |
  Fly     6 LVLLSICFIGHMTDSQLVY-KFTKVECQGNQARVKNVS-CNVKPINWNTALVNLDCYLIYPLI-N 67

  Fly    72 IEIYFQLMTRGSESIHAASNWQPFLHTMKLDLCRFWKNHHNHL--ARMVFEFIDGHTNMNHTC-- 132
            ..|..|:..:     ..::.::|||......||.. ....|.|  |.||:|.....||:. :|  
  Fly    68 PTIRVQVFMK-----DYSNQYKPFLIDATFKLCDV-VERKNFLPYAVMVWELFQRFTNVK-SCHI 125

  Fly   133 --------PYTKEKYISIDDLTNTEVSAKIRGVPMPKGFYALFTTWSTENIT 176
                    .|....|:.                |.|.|.|.:...:|..|.|
  Fly   126 SGQLSARNGYLNSSYVP----------------PFPHGQYQISVMFSDSNST 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33914NP_001027394.2 DUF1091 88..166 CDD:461928 20/89 (22%)
CG33467NP_001286440.1 DUF1091 70..151 CDD:461928 22/103 (21%)

Return to query results.
Submit another query.