DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33914 and CG33475

DIOPT Version :9

Sequence 1:NP_001027394.2 Gene:CG33914 / 3772464 FlyBaseID:FBgn0053914 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_995799.1 Gene:CG33475 / 2768724 FlyBaseID:FBgn0053475 Length:147 Species:Drosophila melanogaster


Alignment Length:145 Identity:28/145 - (19%)
Similarity:54/145 - (37%) Gaps:23/145 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 CAVTTLSKNKNSISLRYAMLKP-----MFTNIEIYFQLMTRGSESIHAASNWQPFLHTMKLDLCR 105
            |....|..|::::.  |..|.|     |..|....|:.:...:...:|.|| :...:...|.:|.
  Fly     5 CLGLELKYNRSNVD--YFGLVPGESQKMMINSTKLFKNIFLDNRIQNAVSN-RTIYNIKNLAICN 66

  Fly   106 FWKNH-HNHLARMVFEFIDGHTNMNHTCPYTKEKYISIDDLTNTEVSAKIRGVPMP----KGFYA 165
            |..|. .:.:..:::|...|::.: ..||.....|.         :|..:|...:|    .|.:.
  Fly    67 FLNNRLISKVYSVIYEGFVGNSTV-FRCPVQPSVYY---------LSNSVREFEVPIFHQPGMFR 121

  Fly   166 LFTTWSTENITRVVT 180
            |:.....|....::|
  Fly   122 LYVKLKAEKEGNMLT 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33914NP_001027394.2 DUF1091 85..166 CDD:284008 16/85 (19%)
CG33475NP_995799.1 DUF1091 54..122 CDD:284008 13/77 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.