DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33914 and AgaP_AGAP013484

DIOPT Version :9

Sequence 1:NP_001027394.2 Gene:CG33914 / 3772464 FlyBaseID:FBgn0053914 Length:189 Species:Drosophila melanogaster
Sequence 2:XP_003436192.1 Gene:AgaP_AGAP013484 / 11175570 VectorBaseID:AGAP013484 Length:205 Species:Anopheles gambiae


Alignment Length:178 Identity:38/178 - (21%)
Similarity:71/178 - (39%) Gaps:30/178 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 TELHGVFMRFTNVTCESKDLSMSIVEYCAVTTLSKNKNSISLRYAMLKP-----MFTNIEIYFQL 78
            |.:....::.|...|.......:.|.||. |.|.:|..:: |..:::.|     ::..::::::.
Mosquito    36 TSIKPYSLKITKYLCVGMPYKRTSVPYCK-TVLRRNHPAV-LNVSVVAPETLNWIWVKVKLFYKF 98

  Fly    79 MTRGSESIHAASNWQPFLHTMKLDLCRFWKNHH-NHLARMVFEFIDGHT-NMNHTCPYTKEKYIS 141
                       |::||||..|:.:.|.:.||.. ..|...|:|.:.... .:.|.||:....|  
Mosquito    99 -----------SSYQPFLIDMEQEACEYVKNRPIIPLTDYVYEIMQKTAPELAHPCPHGNTTY-- 150

  Fly   142 IDDLTNTEVSAKIRGVP--MPKGFYAL-FTTWSTENITRVVTNFYFEV 186
                 |.....:.|..|  :|.|.|.| ...::.:.:|......||.|
Mosquito   151 -----NIVWWLEERYTPKSIPAGDYRLDIQFFAHDKVTLFAVETYFTV 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33914NP_001027394.2 DUF1091 85..166 CDD:284008 22/84 (26%)
AgaP_AGAP013484XP_003436192.1 DUF1091 90..172 CDD:284008 22/99 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20898
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.