DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33723 and CG34303

DIOPT Version :9

Sequence 1:NP_001027235.1 Gene:CG33723 / 3772451 FlyBaseID:FBgn0053723 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001356898.1 Gene:CG34303 / 5740723 FlyBaseID:FBgn0085332 Length:181 Species:Drosophila melanogaster

Alignment Length:177 Identity:41/177 - (23%)
Similarity:81/177 - (45%) Gaps:28/177 - (15%)


  Fly     1 MMYTKLTLLVSLLLLMLIVKEIKPRVEFTNLKCRSVNKDFAEFTQCTLKSINRTYKYISTKVSLH 65
            |...::..|......:.::.::....:|.:|.|..:..:..:...|.:|:|:|.:..|:....|:
  Fly     1 MFSVRVAFLCIFCFNIFVISKVHGSYKFNSLACEVMAPELGKMKLCEIKAIDRKHNMINLSAFLN 65

  Fly    66 KLPITKARVNFGLYKR-FNGYRPFLYNKTLDACHFFQHQKANPVAKYFFDMIKEYSNLNHSCPY- 128
            | .|::..::|.:.|| ..|:.||.|:..:|.|.||::::...::...:..||.|:|:||:||| 
  Fly    66 K-TISEVEIHFKMVKRERGGWHPFFYDIRIDVCQFFKNRRGFFISNLIYSFIKPYTNVNHTCPYM 129

  Fly   129 ------------NNDIIVEKVSTDTVNHHVTKILPYPEGDYMLETHW 163
                        :.|.::.|             .|...|.|.|:|.|
  Fly   130 EGTEMRLWNWSPDEDAVLAK-------------FPVDHGTYGLQTTW 163

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33723NP_001027235.1 DUF1091 74..159 CDD:284008 25/98 (26%)
CG34303NP_001356898.1 DUF1091 73..157 CDD:310821 24/96 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
55.010

Return to query results.
Submit another query.