DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33723 and CG34303

DIOPT Version :8

Sequence 1:NP_001027235.1 Gene:CG33723 / 3772451 FlyBaseID:FBgn0053723 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001356898.1 Gene:CG34303 / 5740723 FlyBaseID:FBgn0085332 Length:181 Species:Drosophila melanogaster

Alignment Length:177 Identity:41/177 - (23%)
Similarity:81/177 - (45%) Gaps:28/177 - (15%)


  Fly     1 MMYTKLTLLVSLLLLMLIVKEIKPRVEFTNLKCRSVNKDFAEFTQCTLKSINRTYKYISTKVSLH 65
            |...::..|......:.::.::....:|.:|.|..:..:..:...|.:|:|:|.:..|:....|:
  Fly     1 MFSVRVAFLCIFCFNIFVISKVHGSYKFNSLACEVMAPELGKMKLCEIKAIDRKHNMINLSAFLN 65

  Fly    66 KLPITKARVNFGLYKR-FNGYRPFLYNKTLDACHFFQHQKANPVAKYFFDMIKEYSNLNHSCPY- 128
            | .|::..::|.:.|| ..|:.||.|:..:|.|.||::::...::...:..||.|:|:||:||| 
  Fly    66 K-TISEVEIHFKMVKRERGGWHPFFYDIRIDVCQFFKNRRGFFISNLIYSFIKPYTNVNHTCPYM 129

  Fly   129 ------------NNDIIVEKVSTDTVNHHVTKILPYPEGDYMLETHW 163
                        :.|.::.|             .|...|.|.|:|.|
  Fly   130 EGTEMRLWNWSPDEDAVLAK-------------FPVDHGTYGLQTTW 163

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33723NP_001027235.1 DUF1091 74..159 CDD:284008 25/98 (26%)
CG34303NP_001356898.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.