DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33723 and CG14518

DIOPT Version :10

Sequence 1:NP_001027235.1 Gene:CG33723 / 3772451 FlyBaseID:FBgn0053723 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster


Alignment Length:185 Identity:54/185 - (29%)
Similarity:91/185 - (49%) Gaps:35/185 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLLLMLIVKEIKPRVE-------FTNLKCRSVNKDFAEFTQCTLKSINRTYKYISTKVSL----H 65
            :|::.::...::|..:       .||..|.:.||.:.||..|.|::::|....::...:|    |
  Fly     4 VLVIWMLAHSLQPPYQCDAVIFKMTNAVCETYNKSWVEFGLCRLRAVSRNKVCLNVDANLLHPVH 68

  Fly    66 KLPITKARVNFGLYKRFNGYRPFLYNKTLDACHFFQHQKANPVAKYFFDMIKEYSNLNHSCPY-- 128
            .: |.|||    |.||.|||:|:||:.:.|.|.|.: ::.|.:.:..:::.||||.:||:|||  
  Fly    69 DV-IVKAR----LLKRANGYKPWLYSVSFDGCQFIR-RRNNALIRIVWELFKEYSTINHTCPYVG 127

  Fly   129 -----NNDIIVEKVSTDTVNHHVTKILPYPEGDYMLETHWMLNDIYCGVIQVYIT 178
                 |..:..||:.|           |.|.|:|:|...|:.|........||.|
  Fly   128 LQQVKNFYLRSEKLPT-----------PIPTGEYLLMIDWVFNKKPQAATNVYFT 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33723NP_001027235.1 DUF1091 74..159 CDD:461928 30/91 (33%)
CG14518NP_651653.2 DM8 83..173 CDD:214778 31/101 (31%)

Return to query results.
Submit another query.