DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33723 and CG33632

DIOPT Version :8

Sequence 1:NP_001027235.1 Gene:CG33723 / 3772451 FlyBaseID:FBgn0053723 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001036537.1 Gene:CG33632 / 3885590 FlyBaseID:FBgn0053632 Length:180 Species:Drosophila melanogaster

Alignment Length:176 Identity:86/176 - (48%)
Similarity:130/176 - (73%) Gaps:1/176 - (0%)


  Fly     2 MYTKLTLLVSL-LLLMLIVKEIKPRVEFTNLKCRSVNKDFAEFTQCTLKSINRTYKYISTKVSLH 65
            |..||.|.|:. |:.:..:.|:...|||||::|.:::|||:.|..|.|:|:||:|||:|.||.|.
  Fly     1 MAIKLKLCVAFQLICIYYLTEVYSLVEFTNVQCETLDKDFSLFEYCYLQSVNRSYKYVSLKVKLL 65

  Fly    66 KLPITKARVNFGLYKRFNGYRPFLYNKTLDACHFFQHQKANPVAKYFFDMIKEYSNLNHSCPYNN 130
            |:|:||.:|.||||||.|||:|||||.|||.|.|.:.:..||:|.||:::.|:|||:||:||||:
  Fly    66 KIPVTKIKVQFGLYKRLNGYKPFLYNMTLDGCRFLKSRNPNPIALYFYNLFKDYSNINHTCPYNH 130

  Fly   131 DIIVEKVSTDTVNHHVTKILPYPEGDYMLETHWMLNDIYCGVIQVY 176
            |::::::|..::|:.:|:|||:|||:|.||.||:..||...:...|
  Fly   131 DLVLDEMSYHSINYKLTEILPFPEGNYKLEVHWIAYDIDRAITTFY 176

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33723NP_001027235.1 DUF1091 74..159 CDD:284008 46/84 (55%)
CG33632NP_001036537.1 DUF1091 74..159 CDD:284008 46/84 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C285864
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.