DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33723 and CG33757

DIOPT Version :9

Sequence 1:NP_001027235.1 Gene:CG33723 / 3772451 FlyBaseID:FBgn0053723 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027398.1 Gene:CG33757 / 3772602 FlyBaseID:FBgn0053757 Length:178 Species:Drosophila melanogaster


Alignment Length:177 Identity:43/177 - (24%)
Similarity:88/177 - (49%) Gaps:19/177 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLVSLLLLMLIVKEIKPRVEFTNLKCRSVNKDFAEFTQCTLKSINRTYKYISTKVSLHKL-PITK 71
            |...|..:::::..::...:|.:|.|.:.::.:.|...|.:|:|||....||  :...:| .:..
  Fly     2 LAAVLFFVLVLLTPLQLEAKFKSLHCTNYDRSYGEILLCKIKAINRYRNSIS--IQFRQLRTVNN 64

  Fly    72 ARVNFGLYKRFNGYRPFLYNKTLDACHFFQHQKANPVAKYFFDMIKEYSNL-NHSCPYNNDIIVE 135
            ..:...|:||.||:||||||.:.:.|.|.. ::.|.:....::.:|.|..: |::||:..:.:::
  Fly    65 VHMRLELFKRANGWRPFLYNISFNLCDFLS-KRNNVIVSLGYEYLKPYIPMTNYTCPFKKNHLIK 128

  Fly   136 KVSTDTVNHHVTKI---LPYPEGDYMLETHWMLNDIYCGVIQVYITL 179
              .|| :...:.|.   .|...|:|.|:..:        ::|..:||
  Fly   129 --CTD-LEFDIEKFRVRFPIETGEYALQLSF--------IVQRKVTL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33723NP_001027235.1 DUF1091 74..159 CDD:284008 25/88 (28%)
CG33757NP_001027398.1 DUF1091 67..152 CDD:284008 25/88 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.