DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33723 and CG33658

DIOPT Version :8

Sequence 1:NP_001027235.1 Gene:CG33723 / 3772451 FlyBaseID:FBgn0053723 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027209.1 Gene:CG33658 / 3772524 FlyBaseID:FBgn0053658 Length:181 Species:Drosophila melanogaster

Alignment Length:156 Identity:80/156 - (51%)
Similarity:118/156 - (75%) Gaps:1/156 - (0%)


  Fly    21 EIKPRVEFTNLKCRSVNKDFAEFTQCTLKSINRTYKYISTKVSLHKLPITKARVNFGLYKRFNGY 85
            :|...:||||.||.|:.||.|:...|.|||:||||:|:||::.:.|| :...:|||||:::.|||
  Fly    23 QIYSHIEFTNFKCTSMAKDVADIEYCFLKSVNRTYQYLSTRIKVLKL-LNSLKVNFGLHQQINGY 86

  Fly    86 RPFLYNKTLDACHFFQHQKANPVAKYFFDMIKEYSNLNHSCPYNNDIIVEKVSTDTVNHHVTKIL 150
            :|||||.|:|.|.|.::.|:|.|||||:|.|:..||||||||||:|||:||::::|:|..:.|.|
  Fly    87 KPFLYNITIDGCQFMKNTKSNVVAKYFYDFIRNISNLNHSCPYNHDIIMEKLTSETINSRLPKTL 151

  Fly   151 PYPEGDYMLETHWMLNDIYCGVIQVY 176
            |:|.|:||.:|:|:.|:.|..|.::|
  Fly   152 PFPTGNYMFQTYWIANEKYRVVTKIY 177

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33723NP_001027235.1 DUF1091 74..159 CDD:284008 49/84 (58%)
CG33658NP_001027209.1 DUF1091 84..160 CDD:284008 44/75 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C285807
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.