DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33723 and CG33690

DIOPT Version :8

Sequence 1:NP_001027235.1 Gene:CG33723 / 3772451 FlyBaseID:FBgn0053723 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027133.1 Gene:CG33690 / 3772513 FlyBaseID:FBgn0053690 Length:170 Species:Drosophila melanogaster

Alignment Length:172 Identity:66/172 - (38%)
Similarity:100/172 - (58%) Gaps:9/172 - (5%)


  Fly     8 LLVSLLLLMLIVKEIKPRVEFTNLKCRSVNKDFAEFTQCTLKSINRTYKYISTKVSLHKLPITKA 72
            |||..||.:.::  ....|.||||.|.|.|.||..|..|.:|::|||:||||....|:::||..|
  Fly     5 LLVKFLLTLPMI--CFCHVTFTNLNCSSYNLDFMSFPTCRIKAVNRTHKYISIYAKLNQVPIVDA 67

  Fly    73 RVNFGLYKRFNGYRPFLYNKTLDACHFFQHQKANPVAKYFFDMIKEYSNLNHSCPYNNDIIVEKV 137
            ||:||..|      ||||:.:.|.|.|.:.|| |.:.|.|:...:..:|:||:|||::|:||:|:
  Fly    68 RVSFGQIK------PFLYDLSYDGCKFMKTQK-NVLVKTFYRTFQRNTNINHTCPYDHDLIVDKL 125

  Fly   138 STDTVNHHVTKILPYPEGDYMLETHWMLNDIYCGVIQVYITL 179
            .|..:.....:.:..|.|||.:.|.|..|.|....:::|:.:
  Fly   126 FTGNLEEEFGRFIIIPNGDYAIYTDWATNKISRASVKIYLKI 167

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33723NP_001027235.1 DUF1091 74..159 CDD:284008 31/84 (37%)
CG33690NP_001027133.1 DUF1091 68..147 CDD:284008 32/85 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C288308
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.