DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33723 and CG33777

DIOPT Version :9

Sequence 1:NP_001027235.1 Gene:CG33723 / 3772451 FlyBaseID:FBgn0053723 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027108.1 Gene:CG33777 / 3772311 FlyBaseID:FBgn0053777 Length:172 Species:Drosophila melanogaster

Alignment Length:175 Identity:81/175 - (46%)
Similarity:121/175 - (69%) Gaps:6/175 - (3%)


  Fly     6 LTLLVSLLLLMLIVKEIKPRVEFTNLKCRSVNKDFAEFTQCTLKSINRTYKYISTKVSLHKLPIT 70
            |..|:.||..:.:|:      :|||:||.|::.:||....|.|||:||||||:|.:|:|.:.|::
  Fly     4 LVYLIQLLFFLFLVE------KFTNIKCTSLDPEFAHVDHCYLKSVNRTYKYLSLRVNLLQKPVS 62

  Fly    71 KARVNFGLYKRFNGYRPFLYNKTLDACHFFQHQKANPVAKYFFDMIKEYSNLNHSCPYNNDIIVE 135
            :.:||...:||:|||:|.|||.|:|||.|.::.|:||||.|.:.:.|:|||:|::||:|:|.|||
  Fly    63 RIKVNAATWKRYNGYKPSLYNFTVDACKFIKNPKSNPVAHYIYRLFKDYSNVNYTCPFNDDAIVE 127

  Fly   136 KVSTDTVNHHVTKILPYPEGDYMLETHWMLNDIYCGVIQVYITLF 180
            |:....||:.||.:||.|.|||:..:||...||....|.||:|:|
  Fly   128 KLPISFVNNQVTSVLPVPSGDYLFSSHWYFYDIKRVTINVYMTIF 172

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33723NP_001027235.1 DUF1091 74..159 CDD:284008 45/84 (54%)
CG33777NP_001027108.1 DUF1091 72..151 CDD:284008 43/78 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472077
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.