DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33723 and CG33777

DIOPT Version :8

Sequence 1:NP_001027235.1 Gene:CG33723 / 3772451 FlyBaseID:FBgn0053723 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027108.1 Gene:CG33777 / 3772311 FlyBaseID:FBgn0053777 Length:172 Species:Drosophila melanogaster

Alignment Length:175 Identity:81/175 - (46%)
Similarity:121/175 - (69%) Gaps:6/175 - (3%)


  Fly     6 LTLLVSLLLLMLIVKEIKPRVEFTNLKCRSVNKDFAEFTQCTLKSINRTYKYISTKVSLHKLPIT 70
            |..|:.||..:.:|:      :|||:||.|::.:||....|.|||:||||||:|.:|:|.:.|::
  Fly     4 LVYLIQLLFFLFLVE------KFTNIKCTSLDPEFAHVDHCYLKSVNRTYKYLSLRVNLLQKPVS 62

  Fly    71 KARVNFGLYKRFNGYRPFLYNKTLDACHFFQHQKANPVAKYFFDMIKEYSNLNHSCPYNNDIIVE 135
            :.:||...:||:|||:|.|||.|:|||.|.::.|:||||.|.:.:.|:|||:|::||:|:|.|||
  Fly    63 RIKVNAATWKRYNGYKPSLYNFTVDACKFIKNPKSNPVAHYIYRLFKDYSNVNYTCPFNDDAIVE 127

  Fly   136 KVSTDTVNHHVTKILPYPEGDYMLETHWMLNDIYCGVIQVYITLF 180
            |:....||:.||.:||.|.|||:..:||...||....|.||:|:|
  Fly   128 KLPISFVNNQVTSVLPVPSGDYLFSSHWYFYDIKRVTINVYMTIF 172

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33723NP_001027235.1 DUF1091 74..159 CDD:284008 45/84 (54%)
CG33777NP_001027108.1 DUF1091 72..151 CDD:284008 43/78 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C286893
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.