DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33723 and CG33641

DIOPT Version :9

Sequence 1:NP_001027235.1 Gene:CG33723 / 3772451 FlyBaseID:FBgn0053723 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027256.1 Gene:CG33641 / 3771970 FlyBaseID:FBgn0053641 Length:181 Species:Drosophila melanogaster


Alignment Length:127 Identity:28/127 - (22%)
Similarity:51/127 - (40%) Gaps:4/127 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KLTLLVSLLLLMLIVK--EIKPRVEFTNLKCRSVNKDFAEFTQCTLKSINRTYKYISTKVSLHK- 66
            :|..:..|..||.:.|  ..:.|:.|.....:....|..|...|.|...|.. .|::.::.|.| 
  Fly     3 RLYFICGLYFLMDLAKCENRRLRIFFDEFAIKYKVPDIFEKMDCNLYQANNR-SYVNVEMKLKKE 66

  Fly    67 LPITKARVNFGLYKRFNGYRPFLYNKTLDACHFFQHQKANPVAKYFFDMIKEYSNLNHSCPY 128
            :.....|.....:|.....:..||:..:|.|...:....|.:..::....|::||:..|||:
  Fly    67 VSDLNVRAIMEFWKPNAQNKMKLYDVRVDGCLILRTIHKNKLFYFYVKSFKKHSNVVLSCPF 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33723NP_001027235.1 DUF1091 74..159 CDD:284008 12/55 (22%)
CG33641NP_001027256.1 DUF1091 80..156 CDD:284008 12/49 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.