DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33723 and CG33642

DIOPT Version :8

Sequence 1:NP_001027235.1 Gene:CG33723 / 3772451 FlyBaseID:FBgn0053723 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027257.1 Gene:CG33642 / 3771733 FlyBaseID:FBgn0053642 Length:187 Species:Drosophila melanogaster

Alignment Length:167 Identity:39/167 - (23%)
Similarity:63/167 - (37%) Gaps:39/167 - (23%)


  Fly    28 FTN---LKC--RSVN------------KDFAEFTQCTLKSINRTYKYISTKVSLHKLPITKARV- 74
            |||   |||  ||..            :|..:.....:.::|.. .|::.::      |.|:.| 
  Fly    15 FTNHICLKCEERSFRIKMNEFAVKYKMRDLIQHIDFRIVNLNNR-SYVNGEM------IVKSDVE 72

  Fly    75 ------NFGLYKRFNGYRPFLYNKTLDACHFFQHQKANPVAKYFFDMIKEYSNLNHSCPYNNDII 133
                  ....:|..|..:..||:..||||.|.:....|.:.|.:....|::.:.|.|||...:. 
  Fly    73 DILMHTTMDFWKTSNQKKIKLYDGRLDACQFLKTSHRNGLFKIYVKSFKKHIHGNLSCPLRTNF- 136

  Fly   134 VEKVSTDTVNHHV-TKILP--YPEGDYMLETHWMLND 167
                :....|.|: .|.||  .|.|.:...|.:...|
  Fly   137 ----NYTLTNWHMDEKDLPPFVPLGTFRTVTEYFTQD 169

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33723NP_001027235.1 DUF1091 74..159 CDD:284008 24/94 (26%)
CG33642NP_001027257.1 DUF1091 79..160 CDD:284008 23/85 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.