DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33723 and CG33137

DIOPT Version :8

Sequence 1:NP_001027235.1 Gene:CG33723 / 3772451 FlyBaseID:FBgn0053723 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster

Alignment Length:165 Identity:39/165 - (23%)
Similarity:66/165 - (40%) Gaps:27/165 - (16%)


  Fly    18 IVKEIKPRVEFTNLKCRSVNKDFAEFTQCTLKSINRTYKYISTKVSLHKLPITKARVNFGLYKR- 81
            ||.::|      |::|.:| ..|:....|.:::||.........|.|.: |:....:.|.:.|: 
  Fly    12 IVYKLK------NIECSTV-PGFSANASCHIRAINWNKAVAEMDVYLLR-PLYNITIRFQILKKD 68

  Fly    82 -FNGYRPFLYNKTLDACHFFQHQKANPVAKYFFDMIKEYSNLNHSCPYNNDIIVEKVSTDTVNHH 145
             .|.::|||.:..::.|.....:...|.......:.:.:||.||||||...::......:     
  Fly    69 YSNKFQPFLVDVVINMCDALSRRSFIPYGLIILKIARTFSNFNHSCPYRGHLMARGAYLN----- 128

  Fly   146 VTKILP--YPEGDYMLETHWMLNDIYCGVIQVYIT 178
             ...||  :|.|.|......|.|         |||
  Fly   129 -ESYLPNVFPLGFYKFNITIMEN---------YIT 153

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33723NP_001027235.1 DUF1091 74..159 CDD:284008 21/88 (24%)
CG33137NP_788343.3 DM8 73..164 CDD:214778 23/96 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C297006
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.