DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33723 and CG33477

DIOPT Version :10

Sequence 1:NP_001027235.1 Gene:CG33723 / 3772451 FlyBaseID:FBgn0053723 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_995797.1 Gene:CG33477 / 2768726 FlyBaseID:FBgn0053477 Length:198 Species:Drosophila melanogaster


Alignment Length:185 Identity:39/185 - (21%)
Similarity:64/185 - (34%) Gaps:72/185 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LVSLLLLMLIVKEIKPR------------VEFTNLKCRSVNKDFAE-----------FTQCTLK- 49
            ::|::.|.|:.....|:            :|..:.:|   :.||.|           :|...:| 
  Fly    25 VISVICLNLVKYLTIPQPIAVQRGNAEYSLESLDTRC---DHDFVEYFHRVPDSKILYTFRVVKL 86

  Fly    50 ----SINRTYKYISTKVSLHKLPITKARVNFGLYKRFNGYRPFLYNKTLDACHFFQHQKANPVAK 110
                :||.|.|.:.|...::|:            :.|.|            |.|..    |||  
  Fly    87 APAFTINITIKVLKTHRIMYKI------------ENFKG------------CEFLN----NPV-- 121

  Fly   111 YFFDMIKE-YSNL--NHS---CPYNNDIIVEKVSTDTVNHHVTKILPYPEGDYML 159
             .|.|..| |..|  |.|   ||...::...|  ||.:...:..:.|:  |.:.|
  Fly   122 -IFKMFGESYKTLVVNGSYFKCPIKPNVYYLK--TDGIMSMIPSVHPF--GRFQL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33723NP_001027235.1 DUF1091 74..159 CDD:461928 21/90 (23%)
CG33477NP_995797.1 DUF1091 100..171 CDD:461928 23/105 (22%)

Return to query results.
Submit another query.