DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33723 and CG33483

DIOPT Version :8

Sequence 1:NP_001027235.1 Gene:CG33723 / 3772451 FlyBaseID:FBgn0053723 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster

Alignment Length:159 Identity:77/159 - (48%)
Similarity:112/159 - (70%) Gaps:0/159 - (0%)


  Fly    21 EIKPRVEFTNLKCRSVNKDFAEFTQCTLKSINRTYKYISTKVSLHKLPITKARVNFGLYKRFNGY 85
            :|...|||||:||.|.:|.|.:|..|.|||:||::||:|.||:|||:||||.:|||.|.||||||
  Fly    70 KIASLVEFTNIKCTSWDKAFDDFEYCHLKSVNRSFKYLSLKVNLHKVPITKVKVNFSLLKRFNGY 134

  Fly    86 RPFLYNKTLDACHFFQHQKANPVAKYFFDMIKEYSNLNHSCPYNNDIIVEKVSTDTVNHHVTKIL 150
            :|||||.|:|||...:|.|.||:..:|:.:.|.:||:||:||:::|:||||:.|:.:|..|...:
  Fly   135 KPFLYNITVDACKALRHSKYNPIFSFFYGLFKHHSNMNHTCPFDHDLIVEKLPTNFMNQKVNGDI 199

  Fly   151 PYPEGDYMLETHWMLNDIYCGVIQVYITL 179
            .:|.|||:..:.|....|....:..::||
  Fly   200 KFPHGDYLFHSDWYAYGINRATVDFFLTL 228

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33723NP_001027235.1 DUF1091 74..159 CDD:284008 43/84 (51%)
CG33483NP_001189327.1 DUF1091 123..208 CDD:284008 43/84 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C288718
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.