DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9f3 and Cyp6a22

DIOPT Version :8

Sequence 1:NP_001350862.1 Gene:Cyp9f3 / 3772405 FlyBaseID:FBgn0038034 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001286431.1 Gene:Cyp6a22 / 49847 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster

Alignment Length:522 Identity:133/523 (25%)
Similarity:230/523 (44%) Gaps:125/523 (24%)


  Fly     4 EFLALFAIATALFYRWASANNDFFKDRGIAYEKPVLYLGNMAGMFLRKRAMLDIVCDLYT--KGG 66
            :.:||..||.|:.:.:......::..|||..|.....:|||.| |.:.:..:|||..:|.  ||.
  Fly     3 DVVALLLIALAVGFWFVRTRYSYWTRRGIGSEPARFPVGNMEG-FRKNKHFIDIVTPIYEKFKGN 66

  Fly    67 SGKFFGIFAQRQPLLMVRDPDLIKQITIKDFDHFIN---HRNEFDTSSDDDPHDMSNLFSSSLFS 128
            ...|.|.|...:|:::|.|.:|.|||.|:||.:|.:   :.||     .|||      .:..||.
  Fly    67 GAPFAGFFMMLRPVVLVTDLELAKQILIQDFANFEDRGMYHNE-----RDDP------LTGHLFR 120

  Fly   129 MRDARWKDMRSTLSPAFTGSKMRQMFQLMNQVAKEAVDCLKQDDSRVQENE----LDMKDYCTRF 189
            :...:|:.:|..:||.||.:||:.||..:.:|.:|    |.|....:.:|.    |::.|...|:
  Fly   121 IDGPKWRPLRQKMSPTFTSAKMKYMFPTVCEVGEE----LTQVCGELADNAMCGILEIGDLMARY 181

  Fly   190 TNDVIASTAFGLQVNSFKDRENTFYQMGKKLTTFTFLQNMKFI--LLFALKSLNKILKVEIFDRK 252
            |:|||...|||::.|..::.|..|..||::  .|:..::.|.:  .:.:...:.:.|::....:.
  Fly   182 TSDVIGRCAFGVECNGLRNPEAEFAIMGRR--AFSERRHCKLVDGFIESFPEVARFLRMRQIHQD 244

  Fly   253 STQYFVRLVLDAMKYRQEHNIVRPDMINML--MEARGIIQTEKTKASAVREWSDRDIVAQCFVFF 315
            .|.::|.:|.:.:|.|:|..|||.|.:|:|  |:.||.:..|             ::.||.|:||
  Fly   245 ITDFYVGIVRETVKQREEQGIVRSDFMNLLIEMKQRGELTIE-------------EMAAQAFIFF 296

  Fly   316 FAGFETSAVLMCFTAHELMENQDVQQRLYEEVQQVDQDLEG-------KELKYLDQVVSEVLRKW 373
            .|||:|||..:.|..:||.:...:|.:|.||:.|..:...|       :||:|::.|::|.|||:
  Fly   297 AAGFDTSASTLGFALYELAKQPALQAKLREEIDQALRLHNGEFTYDSMQELRYMELVIAETLRKY 361

  Fly   374 P--------------------------------------------------------------PA 376
            |                                                              |.
  Fly   362 PILPQLTRISRHLYAAKGDRHFYIEPGQMLLIPVYGIHHDPALYPEPHKFIPERFLADQLAQRPT 426

  Fly   377 IAF------DREC------NKEAKAVIYYLLKDYRFAPAKKSCIPLELISSGFQLSPKGGFWIKL 429
            .|:      .|.|      ..:....:..||:::.|:...::...:|.:.|...|.|..|.::|:
  Fly   427 AAWLPFGDGPRNCIGMRFGKMQTTIGLVSLLRNFHFSVCPRTDPKIEFLKSNILLCPANGIYLKV 491

  Fly   430 VQ 431
            .|
  Fly   492 QQ 493

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp9f3NP_001350862.1 p450 36..>388 CDD:325183 114/446 (26%)
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 123/487 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49747
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.