DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9f3 and Cyp317a1

DIOPT Version :8

Sequence 1:NP_001350862.1 Gene:Cyp9f3 / 3772405 FlyBaseID:FBgn0038034 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001286435.1 Gene:Cyp317a1 / 36667 FlyBaseID:FBgn0033982 Length:518 Species:Drosophila melanogaster

Alignment Length:433 Identity:95/434 (22%)
Similarity:190/434 (44%) Gaps:63/434 (15%)


  Fly     6 LALFAIATALFYRWASANNDFFKDRGIAYEKPVL---YLGNMAGMFLRKRAM-LDIVCDLYTK-G 65
            |.|..||       |....|:::...|.:|:|..   .:..:....|...|| .:....:|.| .
  Fly    16 LVLLIIA-------ARYQRDYWRYLDIPHERPKKLWPIIRQIMTQTLSTEAMKAEHYSAIYKKFK 73

  Fly    66 GSGKFFGIFAQRQPLLMVRDPDLIKQITIKDFDHFINHRNEFDTSSDDDPHDMSNLFSSSLFSMR 130
            |||.|.|.:|..||..::.|.:||:||.||||.:| |.|..: .:...||      .|..|:::|
  Fly    74 GSGPFCGFYALLQPRALILDRELIRQIMIKDFWNF-NDRGLY-CNQKSDP------LSGDLYALR 130

  Fly   131 DARWKDMRSTLSPAFTGSKMRQMFQLMNQVAKEAVDCLKQDDSRVQENELDMKDYCTRFTNDVIA 195
            ...||:||..|.|:..|.:|..::..:.:.|::.:..:.........:.:.::....|:....:|
  Fly   131 GESWKEMRQKLDPSLEGDRMSLLYDCLYEEAEQLLLTVNSTLMSQPHSTVHIQKIMRRYVLSSLA 195

  Fly   196 STAFGLQVNSFKDRENTFYQMGKKLTTFT----FLQNMKFILLFALKSLNKILKVEIFDRKSTQY 256
            ...|||.....|......::...:|...:    :|.|   :::....:..::|::....:::.:|
  Fly   196 KCVFGLNAEQRKTYPLEDFEQMTELALNSHKHGYLMN---LMMIRFPNFCRMLRMRRTPKQAEEY 257

  Fly   257 FVRLVLDAMKYRQEHNIVRPDMINMLMEARGI------IQTEKTKASAVREWSDRDIVAQCFVFF 315
            |::|:...::.|:.....:.|.:.:|::.:.:      .:.:|...:.::    .::.|...||.
  Fly   258 FIKLLTSIVEQRETSGKPQKDYLQLLIDVKALEFITHQYEADKELGAHLQ----NELAAHAVVFL 318

  Fly   316 FAGFETSAVLMCFTAHELMENQDVQQRLYEEVQQVDQDLEG-------KELKYLDQVVSEVLRKW 373
            .||:|.:|..:.:..:||..:.::|.|:.|||::..:..:|       |.|.::.||::|.||..
  Fly   319 KAGYEQTANTLSYVLYELALHPELQVRVREEVKKAIERHDGHITHEGIKSLSFMGQVINETLRMH 383

  Fly   374 PPAIAFDRECNKEAKAVIYYLLK----DYRFAPAKKSCIPLEL 412
            |               :..|:|:    ||......|..:..||
  Fly   384 P---------------ITPYILRRTLNDYAVPDHPKYILVKEL 411

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp9f3NP_001350862.1 p450 36..>388 CDD:325183 80/374 (21%)
Cyp317a1NP_001286435.1 p450 39..466 CDD:299894 87/404 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49761
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.