DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9f3 and Cyp6a13

DIOPT Version :8

Sequence 1:NP_001350862.1 Gene:Cyp9f3 / 3772405 FlyBaseID:FBgn0038034 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_610390.1 Gene:Cyp6a13 / 35837 FlyBaseID:FBgn0033304 Length:493 Species:Drosophila melanogaster

Alignment Length:512 Identity:151/513 (29%)
Similarity:231/513 (45%) Gaps:108/513 (21%)


  Fly     1 MLWEFLALFAIATALF--YRWASANNDFFKDRGIAYEKPVLYLGNMAGMFLRKRAMLDIVCDLYT 63
            ||...:.:|.:...|:  .||   :..::..||:|.|:||.:.|||:|:. |.....||...:|.
  Fly     1 MLTLLVLVFTVGLLLYVKLRW---HYSYWSRRGVAGERPVYFRGNMSGLG-RDLHWTDINLRIYR 61

  Fly    64 K-GGSGKFFGIFAQRQPLLMVRDPDLIKQITIKDFDHFINHRNEFDTSSDDDPHDMSNLFSSSLF 127
            | .|..::.|.|......|.:.|.:||:.|.|:||..|.: |..|....||.       .:.:|.
  Fly    62 KFRGVERYCGYFTFMTKSLFIMDLELIRDIMIRDFSSFAD-RGLFHNVRDDP-------LTGNLL 118

  Fly   128 SMRDARWKDMRSTLSPAFTGSKMRQMFQLMNQVAKEAVDCLKQDDSRVQENELDMKDYCTRFTND 192
            .:....|:.:|..|:..||..||:.||..|.:|.::....     .|:|..|::.||.|.|||.|
  Fly   119 FLDGPEWRWLRQNLTQVFTSGKMKFMFPNMVEVGEKLTQA-----CRLQVGEIEAKDLCARFTTD 178

  Fly   193 VIASTAFGLQVNSFKDRENTFYQMGKKLTTFTFLQNMKFILLFALKSLNKILKVEIFDRKSTQYF 257
            ||.|.||||:.||.:|.|:.|.:||:.:|.......:....:||...|.:.|:..:|..:.:::|
  Fly   179 VIGSCAFGLECNSLQDPESQFRRMGRSVTQEPLHSVLVQAFMFAQPELARKLRFRLFRPEVSEFF 243

  Fly   258 VRLVLDAMKYRQEHNIVRPDMINMLMEARGIIQTEKTKASAVREWSDRDIVAQCFVFFFAGFETS 322
            :..|...:.||:..||.|.|:|.:|||    :..|..|.:.    |...|.||..|||.|||:||
  Fly   244 LDTVRQTLDYRRRENIHRNDLIQLLME----LGEEGVKDAL----SFEQIAAQALVFFLAGFDTS 300

  Fly   323 AVLMCFTAHELMENQDVQQRLYEEVQQV----DQDL---EGKELKYLDQVVSEVLRKWP------ 374
            :..|.|..:||..|.|||:||..||..|    :|.|   ..:|:.||||||:|.|||:|      
  Fly   301 STTMSFCLYELALNPDVQERLRVEVLAVLKRNNQKLTYDSVQEMPYLDQVVAETLRKYPILPHLL 365

  Fly   375 --------------------------------PAI-----AFD---------------------- 380
                                            |.:     .||                      
  Fly   366 RRSTKEYQIPNSNLILEPGSKIIIPVHSIHHDPELYPDPEKFDPSRFEPEEIKARHPFAYLPFGE 430

  Fly   381 --REC------NKEAKAVIYYLLKDYRFAPAKKSCIPLELISSGFQLSPKGGFWIKL 429
              |.|      ..:.|..:.|||:|::|:.::|:.|||:..|..|.:|.:.|..:::
  Fly   431 GPRNCIGERFGKLQVKVGLVYLLRDFKFSRSEKTQIPLKFSSRNFLISTQEGVHLRM 487

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp9f3NP_001350862.1 p450 36..>388 CDD:325183 127/433 (29%)
Cyp6a13NP_610390.1 p450 33..476 CDD:278495 140/465 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49755
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.