DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33766 and CG34260

Sequence 1:NP_001027140.1 Gene:CG33766 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001262120.1 Gene:CG34260 FlyBaseID:FBgn0085289 Length:178 Species:Drosophila melanogaster

Alignment Length:68 Identity:17/69 (25%)
Similarity:30/69 (43%) Gaps:2/69 (3%)


  Fly    90 LDMCSLL-AQRRNNMFKKWFATFFDSGNFKKYCPV-EPNFYYLKNYNYNTLFIPKFLYAGKYRVK 152
            :|.|..| :..:||:..|.|.......|....||| :...|.::||.:.:...|......|::|:
  Fly    91 IDGCKYLGSMYQNNIVGKLFKRLKSVSNLPDSCPVSKGKLYEIRNYTFISDEFPPGAPQAKWQVR 155

  Fly   153 FDM 155
            ..:
  Fly   156 LKL 158

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 16/63 (25%)
CG34260NP_001262120.1 DUF1091 73..154 CDD:284008 16/63 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.