DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33766 and CG14518

Sequence 1:NP_001027140.1 Gene:CG33766 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_651653.2 Gene:CG14518 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster

Alignment Length:175 Identity:32/176 (18%)
Similarity:67/176 (38%) Gaps:44/176 (25%)


  Fly     3 KVVLSISM---SL----ICLIIVPIPTNKILLLESQCGNFNRSYFSNFTMFVKNSQMNMEFFLLR 60
            |:||.|.|   ||    .|..::...||.:      |..:|:|:              :||.|.|
  Fly     2 KIVLVIWMLAHSLQPPYQCDAVIFKMTNAV------CETYNKSW--------------VEFGLCR 46

  Fly    61 VLVPG---VTMDIEFFI------------SMQNSYGFQK-IFQYTLDMCSLLAQRRNNMFKKWFA 109
            :....   |.::::..:            .::.:.|::. ::..:.|.|..:.:|.|.:.:..:.
  Fly    47 LRAVSRNKVCLNVDANLLHPVHDVIVKARLLKRANGYKPWLYSVSFDGCQFIRRRNNALIRIVWE 111

  Fly   110 TFFDSGNFKKYCPVEPNFYYLKNYNYNTLFIPKFLYAGKYRVKFD 154
            .|.:.......||. .....:||:...:..:|..:..|:|.:..|
  Fly   112 LFKEYSTINHTCPY-VGLQQVKNFYLRSEKLPTPIPTGEYLLMID 155

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 13/96 (14%)
CG14518NP_651653.2 DM8 83..173 CDD:214778 13/75 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49104
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.