DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33766 and CG14455

Sequence 1:NP_001027140.1 Gene:CG33766 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_649402.2 Gene:CG14455 FlyBaseID:FBgn0037175 Length:194 Species:Drosophila melanogaster

Alignment Length:168 Identity:35/169 (21%)
Similarity:67/169 (40%) Gaps:29/169 (17%)


  Fly     1 MAKVVLSISMSLICLIIVPIPTN------KILL-----------LESQCGNFNRSYFSNFTMFVK 48
            |.|.|:....::..:::..:|..      |::|           |:.:....|.|..||.::.:|
  Fly     1 MRKEVIRSCCAVAFILVALMPLTGAWRSFKVILTSIDFEANDKFLDLKVDLQNDSGESNLSIDIK 65

  Fly    49 NSQMNMEFFLLRVLVPGVTMDIEFFISMQNSYGFQKIFQYTLDMCSLLAQRRNN-MFKKWFATFF 112
            ..|.          :..|.:.::|.:..... .:..:...||:.|.|:.||.:: :.:..:....
  Fly    66 THQD----------IEDVQLVVDFGLETDKG-NYSTLINRTLNFCKLMKQRNSDPLVRAIYEDLL 119

  Fly   113 DSGNFKKYCPVEPNFYYLKNYNYNTLFIPKFLYAGKYR 150
            ..|...|.||:....|.|.|||.:...:|.||...|:|
  Fly   120 KHGTLFKECPIRSGTYSLTNYNVDEEMLPSFLPEAKFR 157

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 21/85 (25%)
CG14455NP_649402.2 DM8 87..179 CDD:214778 20/72 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C47775
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.