DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33766 and CG33632

DIOPT Version :10

Sequence 1:NP_001027140.1 Gene:CG33766 / 3772380 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001036537.1 Gene:CG33632 / 3885590 FlyBaseID:FBgn0053632 Length:180 Species:Drosophila melanogaster


Alignment Length:165 Identity:38/165 - (23%)
Similarity:70/165 - (42%) Gaps:23/165 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KVVLSISMSLICLIIVPIPTNKILLLESQCGNFNRSYFSNFT-MFVKNSQMNMEFFLLRV---LV 63
            |:.|.::..|||:..:....:.:.....||...::. ||.|. .::::...:.::..|:|   .:
  Fly     4 KLKLCVAFQLICIYYLTEVYSLVEFTNVQCETLDKD-FSLFEYCYLQSVNRSYKYVSLKVKLLKI 67

  Fly    64 PGVTMDIEFFISMQ-NSYGFQKIFQY--TLDMCSLLAQRRNNMFKKWFATFF-DSGNFKKYCP-- 122
            |...:.::|.:..: |.|   |.|.|  |||.|..|..|..|....:|...| |..|....||  
  Fly    68 PVTKIKVQFGLYKRLNGY---KPFLYNMTLDGCRFLKSRNPNPIALYFYNLFKDYSNINHTCPYN 129

  Fly   123 ----VEPNFYYLKNYNYNTLF-IPKFLYAGKYRVK 152
                ::...|:..||....:. .|:    |.|:::
  Fly   130 HDLVLDEMSYHSINYKLTEILPFPE----GNYKLE 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:461928 25/93 (27%)
CG33632NP_001036537.1 DUF1091 78..159 CDD:461928 24/87 (28%)

Return to query results.
Submit another query.