DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33766 and CG33632

Sequence 1:NP_001027140.1 Gene:CG33766 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001036537.1 Gene:CG33632 FlyBaseID:FBgn0053632 Length:180 Species:Drosophila melanogaster

Alignment Length:165 Identity:38/166 (23%)
Similarity:70/166 (42%) Gaps:23/166 (14%)


  Fly     3 KVVLSISMSLICLIIVPIPTNKILLLESQCGNFNRSYFSNFT-MFVKNSQMNMEFFLLRV---LV 63
            |:.|.::..|||:..:....:.:.....||...::. ||.|. .::::...:.::..|:|   .:
  Fly     4 KLKLCVAFQLICIYYLTEVYSLVEFTNVQCETLDKD-FSLFEYCYLQSVNRSYKYVSLKVKLLKI 67

  Fly    64 PGVTMDIEFFISMQ-NSYGFQKIFQY--TLDMCSLLAQRRNNMFKKWFATFF-DSGNFKKYCP-- 122
            |...:.::|.:..: |.|   |.|.|  |||.|..|..|..|....:|...| |..|....||  
  Fly    68 PVTKIKVQFGLYKRLNGY---KPFLYNMTLDGCRFLKSRNPNPIALYFYNLFKDYSNINHTCPYN 129

  Fly   123 ----VEPNFYYLKNYNYNTLF-IPKFLYAGKYRVK 152
                ::...|:..||....:. .|:    |.|:::
  Fly   130 HDLVLDEMSYHSINYKLTEILPFPE----GNYKLE 160

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 25/94 (27%)
CG33632NP_001036537.1 DUF1091 74..159 CDD:284008 25/92 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49189
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.