DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33766 and CG12849

Sequence 1:NP_001027140.1 Gene:CG33766 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_611969.2 Gene:CG12849 FlyBaseID:FBgn0035068 Length:172 Species:Drosophila melanogaster

Alignment Length:157 Identity:29/158 (18%)
Similarity:54/158 (34%) Gaps:45/158 (28%)


  Fly    33 GNFNRSYFSNFTMFVKNSQ-MNMEFFLLRVL---------------VPGVTMDIEFFISMQNSYG 81
            |:|.   |:|....|::.. |:.|:..|:.:               :|....:..|.:.|:.:..
  Fly    19 GHFE---FNNVVCLVRDRMFMDFEYCYLKSVNRTYKYLSLKTKMFRLPVDNCETRFQLRMRENRR 80

  Fly    82 FQKIFQYTLDMCSLLAQRRNNMFKKW-FATFFDSGNFKKYCPVE--------------------- 124
            ....|.:.:|.|..:..|: ::...| :.||....|....||.:                     
  Fly    81 VLYNFDFKVDSCKFMRDRK-HVIANWVYQTFGPYSNLNHTCPYDHDIVLDKLPVQHLNKLVQSII 144

  Fly   125 PNFYYLKNYNYNTLFIPK---FLYAGK 148
            |:..|:.|..:....||:   .||..|
  Fly   145 PDGRYMMNSTWMVAGIPRTDVILYFTK 171

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 20/107 (19%)
CG12849NP_611969.2 DM8 80..172 CDD:214778 18/94 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49176
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.