DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33766 and CG13589

DIOPT Version :10

Sequence 1:NP_001027140.1 Gene:CG33766 / 3772380 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster


Alignment Length:185 Identity:37/185 - (20%)
Similarity:66/185 - (35%) Gaps:69/185 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AKVVLSISMSLICLIIVPIP--TNKILLLESQCGNFNRSYF--------------------SNFT 44
            |..|:|:.:..:.....|:.  ||.:      |.::|:|:.                    :.|.
  Fly     6 AAFVVSVILGFLVCGEAPLAKMTNAV------CKSYNKSWVVVHYCRLKAYSRTKTSLNINATFI 64

  Fly    45 MFVKNSQMNMEFFLLRVLVPGVTMDIEFFISMQNSYGFQK-IFQYTLDMCSLLAQRRNNMFKK-- 106
            ...||..::|:.                   |:.:.|::. :|.||.|.|..: :|||..|.|  
  Fly    65 EPAKNIYLHMKM-------------------MKKANGYKPFLFDYTFDACEFM-RRRNQPFAKIV 109

  Fly   107 WFATFFDSGNFKK-------YCPVEPNFYYLKNYNYNTLFIPKFLYAGKYRVKFD 154
            |        |..|       .||.| ....|.::::  :.:|..|.:|.|.:..|
  Fly   110 W--------NMIKNVSTVNHTCPYE-GLQMLSDFHH--IDVPVPLPSGDYLLLLD 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:461928 23/92 (25%)
CG13589NP_611918.2 DM8 83..171 CDD:214778 22/83 (27%)

Return to query results.
Submit another query.