DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33766 and CG13561

Sequence 1:NP_001027140.1 Gene:CG33766 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_611830.3 Gene:CG13561 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster

Alignment Length:106 Identity:25/107 (23%)
Similarity:48/107 (45%) Gaps:18/107 (17%)


  Fly    42 NFTMF-------VKNS--QMNMEFFLLRVLVPGVTMDIEFFISMQNSYGFQKIFQYTL---DMCS 94
            |||..       ||..  :|::...:||.....|:|.::.   ::.:.|: |.|.|.:   |:|.
  Fly    36 NFTTVSLCRLYAVKRDVVEMSLRANILRWPKGPVSMRMQL---LKKASGY-KPFLYNICQSDVCE 96

  Fly    95 LLAQRRNNMFKKWFATFFDSGNFKKYCPVEPNFYYLKNYNY 135
            .|.:|.:.......::|.:..|..| ||:.|.. .|:::.:
  Fly    97 YLEKRNHPFINIILSSFGNRTNVNK-CPIPPEI-VLEHFRF 135

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 16/72 (22%)
CG13561NP_611830.3 DM8 82..173 CDD:214778 14/58 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49064
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.