DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33766 and CG13561

DIOPT Version :10

Sequence 1:NP_001027140.1 Gene:CG33766 / 3772380 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster


Alignment Length:106 Identity:25/106 - (23%)
Similarity:48/106 - (45%) Gaps:18/106 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 NFTMF-------VKNS--QMNMEFFLLRVLVPGVTMDIEFFISMQNSYGFQKIFQYTL---DMCS 94
            |||..       ||..  :|::...:||.....|:|.::.   ::.:.|: |.|.|.:   |:|.
  Fly    36 NFTTVSLCRLYAVKRDVVEMSLRANILRWPKGPVSMRMQL---LKKASGY-KPFLYNICQSDVCE 96

  Fly    95 LLAQRRNNMFKKWFATFFDSGNFKKYCPVEPNFYYLKNYNY 135
            .|.:|.:.......::|.:..|..| ||:.|.. .|:::.:
  Fly    97 YLEKRNHPFINIILSSFGNRTNVNK-CPIPPEI-VLEHFRF 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:461928 16/71 (23%)
CG13561NP_611830.3 DM8 82..173 CDD:214778 14/57 (25%)

Return to query results.
Submit another query.