DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33766 and CG33658

Sequence 1:NP_001027140.1 Gene:CG33766 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027209.1 Gene:CG33658 FlyBaseID:FBgn0053658 Length:181 Species:Drosophila melanogaster

Alignment Length:168 Identity:36/169 (21%)
Similarity:57/169 (34%) Gaps:59/169 (35%)


  Fly    36 NRSY--------------FSNFT-------------MFVKNSQMNMEFFLLRVLVPGV--TMDIE 71
            ||.|              |:||.             .|:|:.....::...|:.|..:  ::.:.
  Fly    12 NRQYTIAFTKTQIYSHIEFTNFKCTSMAKDVADIEYCFLKSVNRTYQYLSTRIKVLKLLNSLKVN 76

  Fly    72 FFISMQ-NSYGFQKIFQY--TLDMCSLLAQRRNNMFKKWFATFF-DSGNFKKYCPVEPNFYYLK- 131
            |.:..| |.|   |.|.|  |:|.|..:...::|:..|:|..|. :..|....||...:....| 
  Fly    77 FGLHQQINGY---KPFLYNITIDGCQFMKNTKSNVVAKYFYDFIRNISNLNHSCPYNHDIIMEKL 138

  Fly   132 ------------------NYNYNTLFIPKFLYAGKYRV 151
                              ||.:.|.:|..    .||||
  Fly   139 TSETINSRLPKTLPFPTGNYMFQTYWIAN----EKYRV 172

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 25/106 (24%)
CG33658NP_001027209.1 DUF1091 84..160 CDD:284008 18/79 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49201
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.