DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33766 and CG33630

Sequence 1:NP_001027140.1 Gene:CG33766 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027166.1 Gene:CG33630 FlyBaseID:FBgn0053630 Length:212 Species:Drosophila melanogaster

Alignment Length:184 Identity:35/185 (19%)
Similarity:76/185 (41%) Gaps:38/185 (21%)


  Fly     2 AKVVLSISMSLICLIIVPIPTN--KILLLESQCGNFNRSYFSNFTMFVKNSQMNMEFFLLRVLVP 64
            |.|::.:::.::....:...|:  |.::...|...|..|.:....:::...:.:.:..:..|...
  Fly    11 AFVLIRLAIEVVGSYYMEYSTSPKKAVVAIKQIHVFGESNYMKAKIYIHEDRSHFDLHVQLVHEL 75

  Fly    65 G---VTMDIEFFISMQNSYGFQKIFQY-TLDMCSLLAQRRNN-----MFKKWFATFFDSGNFKK- 119
            |   :.|:|:..:..:.|..|.::|:. .::.|..|::...|     ||||         |.|. 
  Fly    76 GSNHLIMNIKVRVKPEGSNAFVQLFELRRINFCEFLSEYNTNPMMEMMFKK---------NVKLN 131

  Fly   120 ---YCPVEPNFYYLKNYNYNTLFIPKFLYA-----GKYR----VKFDMNQLRKI 161
               .|||....|.|.|.:     |.:.::|     |.||    :..::.::.|:
  Fly   132 DIIVCPVRVGNYSLLNSD-----IAENIHADGVQNGTYRFFAEIVEEIGEIAKV 180

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 25/102 (25%)
CG33630NP_001027166.1 DM8 96..186 CDD:214778 23/100 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C47800
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.