DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33766 and CG33679

Sequence 1:NP_001027140.1 Gene:CG33766 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027273.1 Gene:CG33679 FlyBaseID:FBgn0053679 Length:173 Species:Drosophila melanogaster

Alignment Length:175 Identity:34/176 (19%)
Similarity:75/176 (43%) Gaps:19/176 (11%)


  Fly    13 ICLIIVPIPTNKILLLESQCGNFNRSY--FSNFTMFVKNSQM---NMEFFLLRVLVPGVTMDIEF 72
            |.|:.:......:.|...:|.::::|:  |....:.|....:   |:...||::.:..:.:.   
  Fly     7 ISLLFIGESHGYVRLTNLKCESYDKSFVVFPECRLKVLGRGIIGANIHVKLLKLPINRMVVR--- 68

  Fly    73 FISMQNSYGFQK-IFQYTLDMCSLLA-QRRNNMFKKWFATFFDSGNFKKYCPVEPNFYYLKNYNY 135
            ||:.:...|:.. :|..:.:.|.:|. ..|..:|..::..|....|....||...:. |::|...
  Fly    69 FITYRKLNGYHPFLFNVSEEHCRVLRYPNRLRVFYYFYTAFMPFSNINHTCPYNDDI-YIRNCTL 132

  Fly   136 NTLFIPKF-LYAGKYRVKFDMNQLRKIDGVRYF--LVGCAFEVEI 177
            :.....|. |..|.|::..:|:     |||..:  ::...||:::
  Fly   133 DDRMFAKVPLPKGSYKLTLEMD-----DGVVNWISIINIHFEIDV 172

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 18/86 (21%)
CG33679NP_001027273.1 DUF1091 70..149 CDD:284008 17/80 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49163
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.