DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33766 and CG33912

DIOPT Version :10

Sequence 1:NP_001027140.1 Gene:CG33766 / 3772380 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027139.1 Gene:CG33912 / 3772438 FlyBaseID:FBgn0053912 Length:165 Species:Drosophila melanogaster


Alignment Length:116 Identity:26/116 - (22%)
Similarity:47/116 - (40%) Gaps:17/116 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KVVLSIS--MSLICLIIVPIPTNKILLLE---SQCGNFNRSYFSNFTMFVKNSQMNMEFFLLRV- 61
            |::|.||  |...|..     |....|:|   .||.:.::.:......::|:...:.::..::| 
  Fly     4 KLILFISFLMYSTCYF-----TEVYSLVEFANVQCESLDKDFALIEYCYLKSVNRSYKYVSIKVN 63

  Fly    62 --LVPGVTMDIEFFISMQNSYGFQKIFQY--TLDMCSLLAQRRNNMFKKWF 108
              .:|...:.|.|  .:...:...|.|.|  |||.|..|....:|....:|
  Fly    64 LLKLPISKVKIRF--GLYKRFTGYKPFLYNATLDACKFLKSPNSNPVALFF 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:461928 12/43 (28%)
CG33912NP_001027139.1 DUF1091 74..>145 CDD:461928 12/41 (29%)

Return to query results.
Submit another query.