DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33766 and CG33771

DIOPT Version :9

Sequence 1:NP_001027140.1 Gene:CG33766 / 3772380 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027145.3 Gene:CG33771 / 3772424 FlyBaseID:FBgn0053771 Length:178 Species:Drosophila melanogaster


Alignment Length:148 Identity:47/148 - (31%)
Similarity:79/148 - (53%) Gaps:6/148 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MSLICLIIVPIPTNKILLLESQ---CGN--FNRSYFSNFTMFVKNSQMNMEFFLLRVLVPGVTMD 69
            ::|..|:.:...| :|::..||   .||  :|..||.|||:.:.|:.|||:..|.|.:..|....
  Fly     5 LTLFLLVQLVFKT-EIVVGVSQLFVTGNSSYNPKYFKNFTITIANNTMNMDMHLNRPIQRGFKAH 68

  Fly    70 IEFFISMQNSYGFQKIFQYTLDMCSLLAQRRNNMFKKWFATFFDSGNFKKYCPVEPNFYYLKNYN 134
            ::..:.:.|:..||.:|....|:|::.:..:|::||.||.....:.||...||||...||:.::.
  Fly    69 VDILLRLANAKNFQSMFSQKSDVCAVTSSVKNSLFKSWFKDMSKNSNFMYNCPVEVGHYYMHDWR 133

  Fly   135 YNTLFIPKFLYAGKYRVK 152
            ..:....|||..|:||.|
  Fly   134 MGSSMTHKFLIPGEYRGK 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 24/82 (29%)
CG33771NP_001027145.3 DM8 80..171 CDD:214778 25/72 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463906
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FAPI
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I7668
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D73465at7147
OrthoFinder 1 1.000 - - FOG0006712
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.