DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33766 and CG33928

Sequence 1:NP_001027140.1 Gene:CG33766 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027276.1 Gene:CG33928 FlyBaseID:FBgn0053928 Length:180 Species:Drosophila melanogaster

Alignment Length:147 Identity:31/148 (21%)
Similarity:60/148 (41%) Gaps:32/148 (22%)


  Fly    20 IPTNKILLLESQCGNFNRSYFSNFT-MFVKNSQMNMEFFLLRVLVPGVTMDIEFFISM---QNSY 80
            :.:::|.....:|.:.::. ||:|. .|:|.:....::..::|.:..:.:. .|.:::   :.|.
  Fly    22 VESSRIEFTNIKCTSMDKK-FSDFEYCFLKATNRTYKYLSVKVRLYKIPVH-HFTVNLGLHKRSN 84

  Fly    81 GFQKIFQ-YTLDMCSLLAQRRNNMFKKWFATF------------------------FDSGNFKKY 120
            |.....| :|.|.|.::|...|.|....||.|                        |.:..|.||
  Fly    85 GLMPFNQNFTFDGCKMVANVGNPMVLFLFALFKPYSNINHSCPYTHDIIVDKLPTHFVNQQFTKY 149

  Fly   121 CPVEPNFYYLKNYNYNT 137
            .|: |...|:.|.|:.|
  Fly   150 VPL-PEGDYVFNSNWFT 165

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 23/99 (23%)
CG33928NP_001027276.1 DUF1091 75..159 CDD:284008 19/85 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49213
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.