DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33766 and CG33770

Sequence 1:NP_001027140.1 Gene:CG33766 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027144.2 Gene:CG33770 FlyBaseID:FBgn0053770 Length:185 Species:Drosophila melanogaster

Alignment Length:178 Identity:50/179 (28%)
Similarity:97/179 (54%) Gaps:5/179 (3%)


  Fly     1 MAKVVLSISMSLICLIIVPIPTNKILLLESQCGNFNRSYFSNFTMFVKNSQMNMEFFLLRVLVPG 65
            :|::.:.:.:::....|....:.|.:..||:   |||.||.|||..::|.::.::.:|.:.||.|
  Fly    10 LARLEIPLCLAIALFSIRAEGSVKFIAGESR---FNRKYFENFTFTIRNDKIFLDMYLRKPLVRG 71

  Fly    66 VTMDIEFFISMQNSYGFQKIFQYTLDMCSLLAQRRNNMFKKWFATFFDSGNFKKYCPVEPNFYYL 130
            ....::|...:.||..||.:|..::|:|:::...:.|:||||:......|||.:.||:..:.|||
  Fly    72 WRARLDFRTRVGNSKSFQSLFSTSIDVCNIVNAAKINLFKKWYKNLLKYGNFLRQCPLNASHYYL 136

  Fly   131 KNYNYNTLFIPKFLYAGKYRVKFDMNQLRKIDGV-RYFLVGCAFEVEI 177
            :::.:....:|.|:.:|.||:: ..|...|..|. ..|::.|..:..|
  Fly   137 RDWQFGEGLVPPFITSGSYRLE-TYNFFGKYKGKDEDFIMSCTADAII 183

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 26/83 (31%)
CG33770NP_001027144.2 DM8 88..178 CDD:214778 28/91 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131062517
eggNOG 1 0.900 E1_2FAPI
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.