DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33766 and CG33770

DIOPT Version :9

Sequence 1:NP_001027140.1 Gene:CG33766 / 3772380 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027144.2 Gene:CG33770 / 3772256 FlyBaseID:FBgn0053770 Length:185 Species:Drosophila melanogaster


Alignment Length:178 Identity:50/178 - (28%)
Similarity:97/178 - (54%) Gaps:5/178 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKVVLSISMSLICLIIVPIPTNKILLLESQCGNFNRSYFSNFTMFVKNSQMNMEFFLLRVLVPG 65
            :|::.:.:.:::....|....:.|.:..||:   |||.||.|||..::|.::.::.:|.:.||.|
  Fly    10 LARLEIPLCLAIALFSIRAEGSVKFIAGESR---FNRKYFENFTFTIRNDKIFLDMYLRKPLVRG 71

  Fly    66 VTMDIEFFISMQNSYGFQKIFQYTLDMCSLLAQRRNNMFKKWFATFFDSGNFKKYCPVEPNFYYL 130
            ....::|...:.||..||.:|..::|:|:::...:.|:||||:......|||.:.||:..:.|||
  Fly    72 WRARLDFRTRVGNSKSFQSLFSTSIDVCNIVNAAKINLFKKWYKNLLKYGNFLRQCPLNASHYYL 136

  Fly   131 KNYNYNTLFIPKFLYAGKYRVKFDMNQLRKIDGV-RYFLVGCAFEVEI 177
            :::.:....:|.|:.:|.||:: ..|...|..|. ..|::.|..:..|
  Fly   137 RDWQFGEGLVPPFITSGSYRLE-TYNFFGKYKGKDEDFIMSCTADAII 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 25/82 (30%)
CG33770NP_001027144.2 DM8 88..178 CDD:214778 27/90 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463902
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FAPI
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I7668
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D73465at7147
OrthoFinder 1 1.000 - - FOG0006712
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.