DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33766 and CG33627

Sequence 1:NP_001027140.1 Gene:CG33766 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027406.1 Gene:CG33627 FlyBaseID:FBgn0053627 Length:183 Species:Drosophila melanogaster

Alignment Length:162 Identity:35/163 (21%)
Similarity:58/163 (36%) Gaps:29/163 (18%)


  Fly     2 AKVVLSISMSLICLIIVP--IPTNKILLLESQCGNFNRSYFSNFTMFVKN-SQMNMEFFLLRVLV 63
            ||..|.:.......:..|  |..:|.:::|.:     :|..|....::|: :|.|..|       
  Fly    20 AKAHLKLMWKTFNCVTNPDYISEHKCIIVEPE-----KSAISAELQYIKDLAQFNATF------- 72

  Fly    64 PGVTMDIEFFISMQNSYGFQKIFQYTLDMCSLLAQRRNNMFKKWFATFFDSGNFKKYCPVEPNFY 128
                   :.|:..:.|..|||:....:|:|........:.|.......|.....:..||.....|
  Fly    73 -------KLFMPRKPSRSFQKVIDVNVDICQFAKGIHGHRFMTIVIKAFGKQGSQLKCPHTKGLY 130

  Fly   129 YLKNYNY--NTLFIPKFLYAGKYRVKFDMNQL 158
            ...|.|.  |   :|.||....:  |.:||.|
  Fly   131 VYPNINIAEN---LPAFLPETDF--KIEMNFL 157

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 18/85 (21%)
CG33627NP_001027406.1 DUF1091 71..152 CDD:284008 20/100 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.