DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33766 and CG33648

Sequence 1:NP_001027140.1 Gene:CG33766 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027265.2 Gene:CG33648 FlyBaseID:FBgn0053648 Length:178 Species:Drosophila melanogaster

Alignment Length:170 Identity:34/171 (20%)
Similarity:73/171 (43%) Gaps:32/171 (19%)


  Fly    13 ICLIIVPIPTNKILLLE---SQCGNFNRSYFSNFTMFVKNSQMNMEFFLL--RVLVPGVTMDIEF 72
            :.::::....|.:.::|   .:|.:.:.||....:..:|:.....::..:  |:|:..:| :...
  Fly     8 LMIVVILYGINDVSIVEFTNIKCSSSDTSYVYYESCRIKSVNRTYKYISVNSRLLILPLT-NATI 71

  Fly    73 FISMQNSYGFQKIFQY--TLDMCSLLAQRRNNMFKKWFATFFD----SGNFKK-YCP-------- 122
            .:::...|...|.|.|  ::|.|..|..:::|:..|:   .||    ..|.:. .||        
  Fly    72 NVALYKRYNGYKPFLYNVSVDACRFLRTQKSNIVVKY---LFDLILLKSNIRSPTCPFNSFISVD 133

  Fly   123 -VEPNFYYLKNYNYNTLFIPK--FLYAGKYRVKFDMNQLR 159
             :..||  |.|.....|.:|:  :|:|.::   |..|..|
  Fly   134 KLTTNF--LNNKLTQVLPVPEGDYLFAFRW---FSYNIYR 168

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 22/101 (22%)
CG33648NP_001027265.2 DUF1091 71..157 CDD:284008 21/91 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49233
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.