DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33766 and CG33648

DIOPT Version :10

Sequence 1:NP_001027140.1 Gene:CG33766 / 3772380 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027265.2 Gene:CG33648 / 3772188 FlyBaseID:FBgn0053648 Length:178 Species:Drosophila melanogaster


Alignment Length:170 Identity:34/170 - (20%)
Similarity:73/170 - (42%) Gaps:32/170 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ICLIIVPIPTNKILLLE---SQCGNFNRSYFSNFTMFVKNSQMNMEFFLL--RVLVPGVTMDIEF 72
            :.::::....|.:.::|   .:|.:.:.||....:..:|:.....::..:  |:|:..:| :...
  Fly     8 LMIVVILYGINDVSIVEFTNIKCSSSDTSYVYYESCRIKSVNRTYKYISVNSRLLILPLT-NATI 71

  Fly    73 FISMQNSYGFQKIFQY--TLDMCSLLAQRRNNMFKKWFATFFD----SGNFKK-YCP-------- 122
            .:::...|...|.|.|  ::|.|..|..:::|:..|:   .||    ..|.:. .||        
  Fly    72 NVALYKRYNGYKPFLYNVSVDACRFLRTQKSNIVVKY---LFDLILLKSNIRSPTCPFNSFISVD 133

  Fly   123 -VEPNFYYLKNYNYNTLFIPK--FLYAGKYRVKFDMNQLR 159
             :..||  |.|.....|.:|:  :|:|.::   |..|..|
  Fly   134 KLTTNF--LNNKLTQVLPVPEGDYLFAFRW---FSYNIYR 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:461928 22/100 (22%)
CG33648NP_001027265.2 DUF1091 71..157 CDD:461928 20/90 (22%)

Return to query results.
Submit another query.