DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33766 and CG33688

Sequence 1:NP_001027140.1 Gene:CG33766 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027131.1 Gene:CG33688 FlyBaseID:FBgn0053688 Length:175 Species:Drosophila melanogaster

Alignment Length:156 Identity:35/157 (22%)
Similarity:62/157 (39%) Gaps:17/157 (11%)


  Fly    12 LICLIIVPIPT--NKILLLESQCGNFNRSYFSNFTMFVKNSQMNMEFFLLRV-LVPGVTMDIEFF 73
            ||.:|:..:.|  |.:.....:||......:.....|:|......::..:.| |...|..::...
  Fly     6 LILIILGYLATVFNHVTFTNLKCGIRGEKIYYFEKCFIKAVNRTHKYIDIYVNLHQQVVNNVTVI 70

  Fly    74 ISMQNSYGFQKIF-QYTLDMCSLLAQRRNNMFKKWFATFFDSGNFKKYCPVEPNFYYLKNYNYNT 137
            ..|:::.|::..| ..|:|:|..|...|.::.||.:..:.::.|....||            |..
  Fly    71 KLMRHNNGYKPFFVDVTIDVCKFLKDPRQSIIKKLYDIYKNNSNINHTCP------------YKD 123

  Fly   138 LFIPKFLYAGKYRVKFDMNQLRKIDG 163
            :.|...|:.|.....| |..|..|||
  Fly   124 VVIVHHLWTGNLESDF-MKYLPLIDG 148

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 17/84 (20%)
CG33688NP_001027131.1 DUF1091 72..152 CDD:284008 23/91 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.