powered by:
                  
 
    
 
    
             
          
            Protein Alignment CG33766 and CG33775
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_001027140.1 | 
            Gene: | CG33766 / 3772380 | 
            FlyBaseID: | FBgn0053766 | 
            Length: | 178 | 
            Species: | Drosophila melanogaster | 
          
          
            | Sequence 2: | NP_001027410.1 | 
            Gene: | CG33775 / 3772054 | 
            FlyBaseID: | FBgn0053775 | 
            Length: | 182 | 
            Species: | Drosophila melanogaster | 
          
        
        
        
          
            | Alignment Length: | 170 | 
            Identity: | 40/170 - (23%) | 
          
          
            | Similarity: | 70/170 -  (41%) | 
            Gaps: | 37/170 - (21%) | 
          
        
      
- Green bases have known domain annotations that are detailed below.
      | 
 
  Fly     2 AKVVLSISMSLICLIIVPIPTNKILLLESQCGNFNRSYFSNFTMFVKNSQMNMEFFLLRVLVPGV 66 
            |.::.|:|:...|       .:|...:..||.::|.||    .:|.| .::|:   |.|..| |. 
  Fly    14 AAILCSLSLGSEC-------RSKSRFINMQCESYNESY----AVFEK-CKLNL---LGRGRV-GA 62 
 
  Fly    67 TMDIEFF----------ISMQNSY-GFQK-IFQYTLDMCSLLAQRRNNMFKKWFATFFDSG-NFK 118 
            .|.::.|          .:|...| |||. ::..:.|:|.||.......|:.........| |.. 
  Fly    63 DMYLKLFQTPVENCWINWAMYRRYNGFQPFLYNVSTDLCQLLGNPNAISFQGLVINAIKKGSNLN 127 
 
  Fly   119 KYCP-----VEPNFYYLKNYNYNTLFIPKFLYAGKYRVKF 153 
            ..||     :..|..:..:: ..||.:|:.:|  |.:::| 
  Fly   128 HSCPYNHDIIVDNMEFSDDF-LKTLPLPQGVY--KIQLRF 164 
 
       | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | 
            Simple Score | 
            Weighted Score | 
            Original Tool Information | 
          
          
            | BLAST Result | 
            Score | 
            Score Type | 
            Cluster ID | 
          
          
          
            | Compara | 
            1 | 
            0.930 | 
            - | 
            - | 
             | 
            C45447829 | 
          
          
            | Domainoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | eggNOG | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Homologene | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Inparanoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Isobase | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OMA | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoDB | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoFinder | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoInspector | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | orthoMCL | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Panther | 
            1 | 
            1.100 | 
            - | 
            - | 
            P | 
            PTHR20898 | 
          
          
            | Phylome | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | RoundUp | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | SonicParanoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
             | 
            2 | 2.030 | 
             | 
          
        
      
           
             Return to query results.
             Submit another query.