DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33766 and CG33775

Sequence 1:NP_001027140.1 Gene:CG33766 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027410.1 Gene:CG33775 FlyBaseID:FBgn0053775 Length:182 Species:Drosophila melanogaster

Alignment Length:170 Identity:40/171 (23%)
Similarity:70/171 (41%) Gaps:37/171 (22%)


  Fly     2 AKVVLSISMSLICLIIVPIPTNKILLLESQCGNFNRSYFSNFTMFVKNSQMNMEFFLLRVLVPGV 66
            |.::.|:|:...|       .:|...:..||.::|.||    .:|.| .::|:   |.|..| |.
  Fly    14 AAILCSLSLGSEC-------RSKSRFINMQCESYNESY----AVFEK-CKLNL---LGRGRV-GA 62

  Fly    67 TMDIEFF----------ISMQNSY-GFQK-IFQYTLDMCSLLAQRRNNMFKKWFATFFDSG-NFK 118
            .|.::.|          .:|...| |||. ::..:.|:|.||.......|:.........| |..
  Fly    63 DMYLKLFQTPVENCWINWAMYRRYNGFQPFLYNVSTDLCQLLGNPNAISFQGLVINAIKKGSNLN 127

  Fly   119 KYCP-----VEPNFYYLKNYNYNTLFIPKFLYAGKYRVKF 153
            ..||     :..|..:..:: ..||.:|:.:|  |.:::|
  Fly   128 HSCPYNHDIIVDNMEFSDDF-LKTLPLPQGVY--KIQLRF 164

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 22/101 (22%)
CG33775NP_001027410.1 DUF1091 78..160 CDD:284008 20/85 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49167
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.