DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33766 and CG33647

DIOPT Version :10

Sequence 1:NP_001027140.1 Gene:CG33766 / 3772380 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027136.1 Gene:CG33647 / 3772049 FlyBaseID:FBgn0053647 Length:190 Species:Drosophila melanogaster


Alignment Length:159 Identity:34/159 - (21%)
Similarity:71/159 - (44%) Gaps:29/159 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KVVLSISMSLICLIIVPIPTNK-ILLLESQCGNFNRSYFSNFTMFVKNS-----QMNMEFFLLRV 61
            |:.:.:.:.|..||:..:...| :.:.:.:|.|:......|.:.::..:     .:..||.|   
  Fly     5 KLFILVDLILGTLILSSVRAEKEVFMTKIECLNYMPELVRNVSCYLNETSHPTGSIYAEFIL--- 66

  Fly    62 LVPGVTMDIE-----FFISM-QNSYGFQKIFQYT---LDMCSLLAQRRNN-MFKKWFATFFDSGN 116
                 |.|:|     :.::. :.||    :..:|   :|.|.:|:...|: :|:.......::.|
  Fly    67 -----TQDVEDLKGIYILTFKRGSY----VTNFTSSHVDYCQMLSSVENHFLFRMVTTQLRETAN 122

  Fly   117 FKKYCPVEPN-FYYLKNYNYNTLFIPKFL 144
            |...||::.| .||.|.:..|:.|||.::
  Fly   123 FPIQCPLKMNKRYYAKGFTVNSKFIPSYM 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:461928 22/88 (25%)
CG33647NP_001027136.1 DUF1091 <95..156 CDD:461928 17/57 (30%)

Return to query results.
Submit another query.