DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33766 and CG33647

DIOPT Version :9

Sequence 1:NP_001027140.1 Gene:CG33766 / 3772380 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027136.1 Gene:CG33647 / 3772049 FlyBaseID:FBgn0053647 Length:190 Species:Drosophila melanogaster


Alignment Length:159 Identity:34/159 - (21%)
Similarity:71/159 - (44%) Gaps:29/159 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KVVLSISMSLICLIIVPIPTNK-ILLLESQCGNFNRSYFSNFTMFVKNS-----QMNMEFFLLRV 61
            |:.:.:.:.|..||:..:...| :.:.:.:|.|:......|.:.::..:     .:..||.|   
  Fly     5 KLFILVDLILGTLILSSVRAEKEVFMTKIECLNYMPELVRNVSCYLNETSHPTGSIYAEFIL--- 66

  Fly    62 LVPGVTMDIE-----FFISM-QNSYGFQKIFQYT---LDMCSLLAQRRNN-MFKKWFATFFDSGN 116
                 |.|:|     :.::. :.||    :..:|   :|.|.:|:...|: :|:.......::.|
  Fly    67 -----TQDVEDLKGIYILTFKRGSY----VTNFTSSHVDYCQMLSSVENHFLFRMVTTQLRETAN 122

  Fly   117 FKKYCPVEPN-FYYLKNYNYNTLFIPKFL 144
            |...||::.| .||.|.:..|:.|||.::
  Fly   123 FPIQCPLKMNKRYYAKGFTVNSKFIPSYM 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 22/88 (25%)
CG33647NP_001027136.1 DUF1091 <95..156 CDD:284008 17/57 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.