DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33766 and CG33767

Sequence 1:NP_001027140.1 Gene:CG33766 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027141.1 Gene:CG33767 FlyBaseID:FBgn0053767 Length:188 Species:Drosophila melanogaster

Alignment Length:146 Identity:42/147 (29%)
Similarity:80/147 (54%) Gaps:3/147 (2%)


  Fly     6 LSISMSLICLIIVPIPTNKILLLESQCG--NFNRSYFSNFTMFVKNSQMNMEFFLLRVLVPGVTM 68
            :||.|..:|.::..|..:| |.:....|  ||:.:||.|||:.::|:.:.|:....:.:..|:.:
  Fly    13 ISIEMLKVCTLVSIIFVHK-LAITGAAGKSNFSPTYFENFTLEIQNNTLFMDMTTSKPIHRGLKV 76

  Fly    69 DIEFFISMQNSYGFQKIFQYTLDMCSLLAQRRNNMFKKWFATFFDSGNFKKYCPVEPNFYYLKNY 133
            .:...||:.....:|::|.:.||.|.:::..|.|:||.||.:....|||...|||....|:|:::
  Fly    77 LLNTQISLDKGRSYQRLFAHILDTCGVVSSVRGNLFKSWFDSMLKHGNFMVNCPVPAGHYFLRDW 141

  Fly   134 NYNTLFIPKFLYAGKY 149
            ..::..:|.::..|.|
  Fly   142 KLDSHLVPHYMLPGDY 157

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 24/83 (29%)
CG33767NP_001027141.1 DM8 90..180 CDD:214778 22/69 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131062493
eggNOG 1 0.900 E1_2FAPI
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.