powered by:
                   
 
    
    
             
          
            Protein Alignment CG33766 and CG33641
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_001027140.1 | Gene: | CG33766 / 3772380 | FlyBaseID: | FBgn0053766 | Length: | 178 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_001027256.1 | Gene: | CG33641 / 3771970 | FlyBaseID: | FBgn0053641 | Length: | 181 | Species: | Drosophila melanogaster | 
        
        
        
          
            | Alignment Length: | 119 | Identity: | 29/119 - (24%) | 
          
            | Similarity: | 51/119 -  (42%) | Gaps: | 19/119 - (15%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly    36 NRSYFSNFTMFVKN--SQMNMEFFLLRVLVPGVTMDIEFFISMQNSYGFQKIFQYTLDMCSLLAQ 98||||. |..|.:|.  |.:|:...:            ||:  ..|:....|::...:|.|.:|..
 Fly    53 NRSYV-NVEMKLKKEVSDLNVRAIM------------EFW--KPNAQNKMKLYDVRVDGCLILRT 102
 
 
  Fly    99 -RRNNMFKKWFATFFDSGNFKKYCPVEPNF-YYLKNYNYNTLFIPKFLYAGKYR 150.:|.:|..:..:|....|....||.:.|| |.:.::..:...:|.|...|::|
 Fly   103 IHKNKLFYFYVKSFKKHSNVVLSCPFKANFTYKMDDWFLDEEELPPFAPVGQFR 156
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 0 | 0.000 | Not matched by this tool. | 
          
            | Domainoid | 0 | 0.000 | Not matched by this tool. | 
          
            | eggNOG | 0 | 0.000 | Not matched by this tool. | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Isobase | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoDB | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoFinder | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoInspector | 0 | 0.000 | Not matched by this tool. | 
          
            | orthoMCL | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 1 | 1.100 | - | - | P | PTHR20898 | 
          
            | Phylome | 0 | 0.000 | Not matched by this tool. | 
          
            | RoundUp | 0 | 0.000 | Not matched by this tool. | 
          
            | SonicParanoid | 0 | 0.000 | Not matched by this tool. | 
          
            |  | 1 | 1.100 |  | 
        
      
           
             Return to query results.
             Submit another query.