DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33766 and CG33783

DIOPT Version :9

Sequence 1:NP_001027140.1 Gene:CG33766 / 3772380 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027168.1 Gene:CG33783 / 3771958 FlyBaseID:FBgn0053783 Length:164 Species:Drosophila melanogaster


Alignment Length:165 Identity:31/165 - (18%)
Similarity:62/165 - (37%) Gaps:44/165 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 TNKILLLESQCGNFNRSYFSNFTMFVKNSQMNMEFFLLRVLVPGVTMDIEFFISMQ------NS- 79
            ||.|.::..:|..:.:|:..     :|..:       |:||..|:   :..|:..|      || 
  Fly     5 TNPIGVVNIKCTCYEKSFCE-----LKRCE-------LKVLGRGI---VGLFLHAQAHQLPINSS 54

  Fly    80 ----------YGFQK-IFQYTLDMCSLLAQRRNNMFKKWFATFFDS----GNFKKYCPVEPNFYY 129
                      .|::. ::..|:|:||....|:...|   ....:|:    .|....||...:...
  Fly    55 TCILSLYRRFNGYRPFLYNMTVDICSFFKNRKRYPF---VDLVYDAIKNFSNVNHSCPHNHDIIV 116

  Fly   130 LKNYNYNTLFIPKFLYAGKYRVKFDMNQLRKIDGV 164
            .:....:.:.:.....:|.|::.|    :.|.||:
  Fly   117 NRMVLNDNMIVKVPFPSGFYKLMF----ILKTDGI 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:461928 17/104 (16%)
CG33783NP_001027168.1 DUF1091 60..138 CDD:461928 13/80 (16%)


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - -
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.