DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33766 and CG33702

Sequence 1:NP_001027140.1 Gene:CG33766 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027120.1 Gene:CG33702 FlyBaseID:FBgn0053702 Length:179 Species:Drosophila melanogaster

Alignment Length:155 Identity:38/156 (24%)
Similarity:59/156 (38%) Gaps:37/156 (24%)


  Fly    25 ILLLESQCGNFNRSYFSNFTMFVKNSQMNMEFF--------LLRVLVPGVTM-----------DI 70
            |:|..|..|...|  |:||    |...::.||.        ::|..|.|:..           .|
  Fly    13 IILFSSTLGAHFR--FTNF----KCISLDPEFAVVKECILKMVRRSVVGINFHIAIKYSQPINKI 71

  Fly    71 EFFISMQNSYGFQKIF--QYTLDMCSLLAQRRNNMFKKWFATFFDS----GNFKKYCPVEPNFYY 129
            ||.:|:.......::|  .:|:|.|..:  ||...: ..|..|.||    .|....||......|
  Fly    72 EFNLSIFRKSNMYRLFLVNHTIDFCYYM--RRPEQY-PIFYMFHDSLMAATNANHSCPYTEKDIY 133

  Fly   130 LKNYNYNTLFIP---KFLYAGKYRV 151
            :|...:|...:.   .||..|:|::
  Fly   134 VKKMTFNDKTLKDLLSFLPVGEYKL 158

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 24/103 (23%)
CG33702NP_001027120.1 DUF1091 73..158 CDD:284008 22/88 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49133
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.