DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33766 and CG33796

DIOPT Version :10

Sequence 1:NP_001027140.1 Gene:CG33766 / 3772380 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027128.1 Gene:CG33796 / 3771914 FlyBaseID:FBgn0053796 Length:179 Species:Drosophila melanogaster


Alignment Length:161 Identity:35/161 - (21%)
Similarity:70/161 - (43%) Gaps:14/161 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KVVLSI--SMSLICLIIVPIPTNKIL--LLESQCGNFNRSY--FSNFTMFVKNSQMNMEFFLLRV 61
            |.||.|  |::::||:|:. |:|.::  |....||::|:::  .:...:...|....:..|....
  Fly     2 KYVLKIVVSLTILCLMILK-PSNPVVFKLTNVHCGSYNKTWIRINQCRLKAINRHRTVFNFNATF 65

  Fly    62 LVP--GVTMDIEFFISMQNSYGFQKIFQYTLDMCSLLAQRRNNMFKKWFATFFDSGNFKKYCPVE 124
            |.|  .:|:..:.| ..:|.|. ..:....:|.|..|.:..:.:....|..:.:..|....||::
  Fly    66 LYPTKSITVHYQTF-KRENGYR-PWLVNTQIDGCRFLRKPYDALGILLFNIYRNFTNINHTCPLQ 128

  Fly   125 PNFYYLKNY-NYNTLFIPKFLYAGKYRVKFD 154
            .:......| ..:.:.:|  |..|.|.:..|
  Fly   129 GDMIVRNMYLTTDVMRLP--LPTGDYLLAID 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:461928 15/83 (18%)
CG33796NP_001027128.1 DUF1091 74..154 CDD:461928 15/83 (18%)

Return to query results.
Submit another query.