DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33766 and CG33752

Sequence 1:NP_001027140.1 Gene:CG33766 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027409.1 Gene:CG33752 FlyBaseID:FBgn0053752 Length:185 Species:Drosophila melanogaster

Alignment Length:194 Identity:35/195 (18%)
Similarity:75/195 (38%) Gaps:38/195 (19%)


  Fly     8 ISMSLICLIIVPIPTNKILLLES-------QCGNFNRSYFSNFTMFVKN--------SQMNMEFF 57
            |.:.:.|.|.:.:..|.    ||       :|...::| |:.|.:...|        ..:.|:| 
  Fly     4 IIIRVFCTITLSLEING----ESITRHTNVKCEVLDKS-FAEFPVCKLNVLGRGIIAESVYMKF- 62

  Fly    58 LLRVLVPGVTMDIEFFISMQNSYGFQKIFQYTLDMCSLLAQ-RRNNMFKKWFATFFDSGNFKKYC 121
             |::.:..::::...:..:...:.|  :|..|:|.|..:.. ...|:|..::.......||...|
  Fly    63 -LKLPIKKISVNFTVYKKLSGYHPF--LFNVTVDFCHYMKHPNPMNIFHYFYTAVKPYSNFNHSC 124

  Fly   122 PVEPNFYYLKNYNYNTLFIPKFLYAGKYRVKFDM---NQLRKI----DGVRYFLVGCAFEVEIK 178
            |      |..:.:|:.:.:..|:.......|..:   |.:..|    |.|...::...|:|.::
  Fly   125 P------YNVSESYHDILVKDFVLTDTMFAKIPLPTGNYMFSIKLATDDVWRVVLNTYFDVNVE 182

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 14/84 (17%)
CG33752NP_001027409.1 DUF1091 72..159 CDD:284008 16/95 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49159
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.