DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33766 and CG33768

Sequence 1:NP_001027140.1 Gene:CG33766 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027142.2 Gene:CG33768 FlyBaseID:FBgn0053768 Length:175 Species:Drosophila melanogaster

Alignment Length:180 Identity:46/181 (25%)
Similarity:81/181 (45%) Gaps:27/181 (15%)


  Fly    10 MSLICLIIV----PIPTNKILLLESQCGNFNRSYFSNFTMFVKNSQMNMEFFLLRVLVPGVTMDI 70
            :.::|:::|    ...::.:.|...||.. |..:|:...:...||.:..:..||:.|..|....:
  Fly     2 LKIVCVLMVIFVSQAVSSSVTLNRVQCEK-NAKFFATLNVTSVNSTIYADIELLQALKAGFRGHV 65

  Fly    71 EFFISMQNSYGFQKIFQYTLDMCSLLAQRRNNMFKKWFATFFDSGNFKKYCPVEPNFYYLKNYNY 135
            :..:.:.|:..||.:.|...|.|.||:..::::|::|..:...:.||.:.|||....||||.::.
  Fly    66 DVQLRLSNAKKFQSLVQADTDYCELLSTLKDSLFRRWIKSVSKNSNFMENCPVPAGHYYLKGWHV 130

  Fly   136 NTLFIPKFL-----------YAGKYRVKFDMNQLRKIDGVRYFLVGCAFE 174
            ....:|.:|           |.||||.|..|           |||.|..|
  Fly   131 EMGLVPSYLLSGDYLLSALVYYGKYRSKKQM-----------FLVRCMVE 169

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 26/94 (28%)
CG33768NP_001027142.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131062544
eggNOG 1 0.900 E1_2FAPI
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.